Started [../scripts/dncon2-main.pl]: Tue May 7 15:46:52 2019 Input: ./input/3e7u.fasta L : 40 Seq : GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY [[Executing: cp ./input/3e7u.fasta ./output/3e7u-2019-May-07//]] [[Executing: echo ">3e7u" > ./output/3e7u-2019-May-07//3e7u.fasta]] [[Executing: echo "GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY" >> ./output/3e7u-2019-May-07//3e7u.fasta]] Generating PSSM.. [[Executing: mkdir -p /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/pssm]] [[Executing: cp ../3e7u.fasta ./]] Looks like .pssm file is already here.. skipping.. Predicting secondary structure and solvent accessibility using SCRATCH.. [[Executing: mkdir -p /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa]] [[Executing: cp ../3e7u.fasta ./]] Looks like .aln file is already here.. skipping.. [[Executing: cp /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.fasta /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.ss_sa]] [[Executing: echo ">3e7u" > /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.ss_sa]] [[Executing: echo "GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY" >> /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.ss_sa]] [[Executing: tail -n 1 /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.ss >> /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.ss_sa]] [[Executing: tail -n 1 /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.acc >> /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.ss_sa]] [[Executing: sed -i 's/-/b/g' /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/ss_sa/3e7u.ss_sa]] Predicted SS and SA: >3e7u GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY CCCECCCCCECHHHHHHHHHHCCCCCCEEEECCCCEEEEC eebbebeeeeeeeebeeebeeeeeeebbebbeebeebeee Predicting secondary structure and solvent accessibility using PSIPRED.. [[Executing: mkdir -p /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07/psipred]] [[Executing: echo ">3e7u" > ./3e7u.fasta]] [[Executing: echo "GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY" >> ./3e7u.fasta]] Looks like .solv file is already here.. skipping.. Generating alignments.. [[Executing: mkdir -p alignments]] [[Executing: /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/generate-alignments.pl 3e7u.fasta alignments]] Started [/data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/generate-alignments.pl]: Tue May 7 15:46:52 2019 Starting job hhb-cov60.sh .. running hhblits job hhb-cov60.. Wait until all HHblits jobs are done .. 1 jobs running currently hhblits hhb-cov60 job done. 0 jobs running currently Alignment Summary: L = 40 221 hhb-cov60.aln Copying hhb-cov60.aln as 3e7u.aln HHblits jobs have enough alignments! Not running JackHmmer! Finished [/data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/generate-alignments.pl]: Tue May 7 15:49:02 2019 Generate alignment stats .. [[Executing: mkdir -p alnstat]] [[Executing: cp alignments/3e7u.aln ./alnstat/]] [[Executing: cp alignments/3e7u.aln ./alnstat/]] [[Executing: /data/jh7x3/multicom_github/multicom/tools/DNCON2/metapsicov/bin/alnstats 3e7u.aln 3e7u.colstats 3e7u.pairstats]] Contact Predictions .. [[Executing: mkdir -p psicov]] [[Executing: mkdir -p ccmpred]] [[Executing: mkdir -p freecontact]] Running PSICOV, CCmpred, and FreeContact parallely.. [[Executing: /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/run-ccmpred-freecontact-psicov.pl alignments/3e7u.aln psicov ccmpred freecontact]] Started [/data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/run-ccmpred-freecontact-psicov.pl]: Tue May 7 15:49:02 2019 Starting job 3e7u-d0.03.sh .. Starting job 3e7u-r0.01.sh .. Starting job 3e7u-r0.001.sh .. Starting job 3e7u-ccmpred.sh .. Starting job 3e7u-freecontact.sh .. running freecontact .. freecontact job done. Wait for max 24 hours until all jobs are done .. Attempting to kill psicov processes that aren't finished.. Checking FreeContact prediction.. Checking CCMpred prediction.. Checking PSICOV predictions.. Looks like PSICOV 'd-0.03' option has already finished! Finished [/data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/run-ccmpred-freecontact-psicov.pl]: Tue May 7 15:49:32 2019 Verify coevolution-based contact predictions .. Generating feature file.. /data/jh7x3/multicom_github/multicom/tools/DNCON2/dry-run/output/3e7u-2019-May-07 [[Executing: /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/generate-dncon2-features.pl ./3e7u.fasta ./pssm/3e7u.pssm ./ss_sa/3e7u.ss_sa ./alnstat/3e7u.colstats ./alnstat/3e7u.pairstats ./freecontact/3e7u.freecontact.rr ./ccmpred/3e7u.ccmpred ./psicov/3e7u.psicov.rr ./psipred/3e7u.ss2 ./psipred/3e7u.solv > feat-3e7u.txt]] Strip leading spaces from feature files.. [[Executing: sed -i 's/^ *//g' feat-3e7u.txt]] Predict RR from features [[Executing: /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/predict-rr-from-features.sh feat-3e7u.txt 3e7u.rr.raw 3e7u.feat.stage2.txt]] # Predict stage1 coevolution-based features (and prepare stage2 feature file).. Running prediction using coevo-60A .. Using Theano backend. Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid SCRIPT : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/cnn-predict-and-append-to-X.py dir_config : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend file_weights : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage1-60A.hdf5 string_header : 60A fileX : feat-3e7u.txt fileX_stage2 : 3e7u.feat.stage2.txt Running prediction using coevo-75A .. Using Theano backend. Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid SCRIPT : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/cnn-predict-and-append-to-X.py dir_config : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend file_weights : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage1-75A.hdf5 string_header : 75A fileX : feat-3e7u.txt fileX_stage2 : 3e7u.feat.stage2.txt Running prediction using coevo-80A .. Using Theano backend. Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid SCRIPT : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/cnn-predict-and-append-to-X.py dir_config : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend file_weights : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage1-80A.hdf5 string_header : 80A fileX : feat-3e7u.txt fileX_stage2 : 3e7u.feat.stage2.txt Running prediction using coevo-85A .. Using Theano backend. Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid SCRIPT : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/cnn-predict-and-append-to-X.py dir_config : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend file_weights : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage1-85A.hdf5 string_header : 85A fileX : feat-3e7u.txt fileX_stage2 : 3e7u.feat.stage2.txt Running prediction using coevo-10A .. Using Theano backend. Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid SCRIPT : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/cnn-predict-and-append-to-X.py dir_config : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend file_weights : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage1-10A.hdf5 string_header : 10A fileX : feat-3e7u.txt fileX_stage2 : 3e7u.feat.stage2.txt All features in final X: # Sequence Length (log) # alignment-count (log) # effective-alignment-count (log) # Relative 'b' count # Relative 'H' count # Relative 'E' count # AA composition # Atchley factors # Secondary Structure # Solvent accessibility # PSSM inf feature # PSSM # PSSM Sums (divided by 100) # PSSM sum cosines # Relative sequence separation # Sequence separation between 23 and 28 # Sequence separation between 28 and 38 # Sequence separation between 38 and 48 # Sequence separation 48+ # Psipred # Psisolv # pref score # scld lu con pot # levitt con pot # braun con pot # joint entro # pearson r # Shannon entropy sum # ccmpred # freecontact # psicov # pstat_pots # pstat_mimt # pstat_mip # Prediction at 60A # Prediction at 75A # Prediction at 80A # Prediction at 85A # Prediction at 10A Predict stage2.. Using Theano backend. SCRIPT : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/cnn-predict-stage2.py dir_config : /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend fileX : 3e7u.feat.stage2.txt fileRR : 3e7u.rr.raw.tmp Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-1.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-2.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-3.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-4.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-5.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-6.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-7.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-8.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-9.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-10.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-11.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-12.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-13.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-14.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-15.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-16.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-17.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-18.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-19.hdf5 .. Reading weight file /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-20.hdf5 .. FeatID Avg Med Max Sum Avg[30] Med[30] Max[30] Sum[30] Feat 0 2.3609 3.6889 3.6889 5902.2 2.9511 3.6889 3.6889 147.5560 Feat 1 3.4548 5.3982 5.3982 8637.1 4.3185 5.3982 5.3982 215.9265 Feat 2 2.2380 3.4968 3.4968 5594.9 2.7975 3.4968 3.4968 139.8729 Feat 3 0.1792 0.2800 0.2800 448.0 0.2240 0.2800 0.2800 11.2000 Feat 4 0.1600 0.2500 0.2500 400.0 0.2000 0.2500 0.2500 10.0000 Feat 5 0.1600 0.2500 0.2500 400.0 0.2000 0.2500 0.2500 10.0000 Feat 6 0.2723 0.1100 1.0000 680.8 0.1920 0.2400 0.2400 9.6000 Feat 7 0.2723 0.1100 1.0000 680.8 0.3404 0.3000 1.0000 17.0200 Feat 8 0.3347 0.2700 1.0000 836.8 0.0480 0.0600 0.0600 2.4000 Feat 9 0.3347 0.2700 1.0000 836.8 0.4184 0.4000 1.0000 20.9200 Feat10 0.3992 0.5000 1.0000 998.0 0.4080 0.5100 0.5100 20.4000 Feat11 0.3992 0.5000 1.0000 998.0 0.4990 0.5250 1.0000 24.9500 Feat12 0.3442 0.3000 1.0000 860.4 0.8000 1.0000 1.0000 40.0000 Feat13 0.3442 0.3000 1.0000 860.4 0.4302 0.4700 1.0000 21.5100 Feat14 0.3754 0.4900 0.8600 938.4 0.4000 0.5000 0.5000 20.0000 Feat15 0.3754 0.4900 0.8600 938.4 0.4692 0.5000 0.8600 23.4600 Feat16 0.1600 0.0000 1.0000 400.0 0.0000 0.0000 0.0000 0.0000 Feat17 0.1600 0.0000 1.0000 400.0 0.2000 0.0000 1.0000 10.0000 Feat18 0.1600 0.0000 1.0000 400.0 0.8000 1.0000 1.0000 40.0000 Feat19 0.1600 0.0000 1.0000 400.0 0.2000 0.0000 1.0000 10.0000 Feat20 0.3200 0.0000 1.0000 800.0 0.0000 0.0000 0.0000 0.0000 Feat21 0.3200 0.0000 1.0000 800.0 0.4000 0.0000 1.0000 20.0000 Feat22 0.4640 0.0000 1.0000 1160.0 0.0000 0.0000 0.0000 0.0000 Feat23 0.4640 0.0000 1.0000 1160.0 0.5800 1.0000 1.0000 29.0000 Feat24 0.0913 0.0850 0.3817 228.3 0.0534 0.0667 0.0667 2.6680 Feat25 0.0913 0.0850 0.3817 228.3 0.1141 0.1208 0.3817 5.7065 Feat26 0.6400 1.0000 1.0000 1600.0 0.8000 1.0000 1.0000 40.0000 Feat27 0.6400 1.0000 1.0000 1600.0 0.8000 1.0000 1.0000 40.0000 Feat28 0.0670 0.0000 1.0000 167.5 0.0378 0.0000 1.0000 1.8900 Feat29 0.2132 0.1200 0.9700 533.0 0.2548 0.1850 0.7500 12.7400 Feat30 0.0600 0.0000 1.0000 150.0 0.1000 0.0000 1.0000 5.0000 Feat31 0.0600 0.0000 1.0000 150.0 0.0600 0.0000 1.0000 3.0000 Feat32 0.0024 0.0000 1.0000 6.0 0.0000 0.0000 0.0000 0.0000 Feat33 0.0000 0.0000 0.0000 0.0 0.0000 0.0000 0.0000 0.0000 Feat34 0.3646 0.2730 0.9970 911.4 0.3120 0.3900 0.3900 15.6000 Feat35 0.3646 0.2730 0.9970 911.4 0.4557 0.4475 0.9970 22.7860 Feat36 0.0872 0.0040 0.6060 218.1 0.0280 0.0350 0.0350 1.4000 Feat37 0.0872 0.0040 0.6060 218.1 0.1091 0.0100 0.6060 5.4530 Feat38 0.1498 0.0200 0.8360 374.6 0.4088 0.5110 0.5110 20.4400 Feat39 0.1498 0.0200 0.8360 374.6 0.1873 0.0570 0.8360 9.3650 Feat40 0.1965 0.1520 0.9510 491.2 0.2464 0.3080 0.3080 12.3200 Feat41 0.1965 0.1520 0.9510 491.2 0.2456 0.2225 0.9510 12.2800 Feat42 0.1869 0.0880 0.9840 467.2 0.4478 0.4080 0.9840 22.3880 Feat43 0.4130 0.5400 1.0000 1032.4 0.5595 0.6110 0.9050 27.9750 Feat44 0.4008 0.5000 1.0000 1001.9 0.6231 0.7890 0.9740 31.1560 Feat45 0.3594 0.4600 1.0000 898.6 0.4544 0.5060 0.7140 22.7190 Feat46 0.0167 0.0000 0.2140 41.7 0.0107 0.0000 0.1070 0.5340 Feat47 0.3372 0.4740 1.0000 842.9 0.3983 0.4740 1.0000 19.9140 Feat48 0.5143 0.7160 0.9490 1285.8 0.7408 0.9260 0.9260 37.0400 Feat49 0.5143 0.7160 0.9490 1285.8 0.6429 0.7645 0.9490 32.1440 Feat50 0.1682 0.1970 1.0000 420.5 0.2170 0.2110 1.0000 10.8488 Feat51 0.2812 0.0000 8.1614 703.1 0.2985 0.0000 2.9122 14.9262 Feat52 0.2494 0.0000 6.9790 623.5 0.5082 0.0000 6.9790 25.4113 Feat53 0.3157 0.4834 0.5417 789.2 0.4064 0.5062 0.5329 20.3223 Feat54 0.3178 0.4910 0.5724 794.5 0.3966 0.4915 0.5276 19.8292 Feat55 0.3200 0.4931 0.5734 799.9 0.4000 0.4971 0.5331 19.9990 Feat56 0.0897 0.0023 1.0000 224.3 0.1343 0.0310 1.0000 6.7131 Feat57 0.1299 0.0119 1.0000 324.8 0.1895 0.0382 1.0000 9.4767 Feat58 0.1315 0.0159 1.0000 328.7 0.2086 0.0312 1.0000 10.4275 Feat59 0.1349 0.0137 1.0000 337.1 0.2213 0.0486 1.0000 11.0642 Feat60 0.2413 0.1104 1.0000 603.3 0.3837 0.3194 0.9999 19.1845 Starting ensemble prediction.. Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-11.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-2.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-1.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-6.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-12.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-18.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-20.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-17.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-4.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-19.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-7.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-13.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-14.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-16.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-5.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-15.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-10.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-9.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-3.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Running prediction using /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/stage2-8.hdf5 and /data/jh7x3/multicom_github/multicom/tools/DNCON2/scripts/../model-config-n-weights-theano-backend/model-arch.config Read model architecture: layer0 : 16 5 1 relu layer1 : 16 5 1 relu layer2 : 16 5 1 relu layer3 : 16 5 1 relu layer4 : 16 5 1 relu layer5 : 16 5 1 relu layer6 : 1 5 0 sigmoid Writing RR file 3e7u.rr.raw.tmp Preparing predictions.. [[Executing: mkdir -p predictions]] [[Executing: rm -f predictions/*]] [[Executing: echo "GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY" > ./predictions/3e7u.psicov.rr]] [[Executing: cat ./psicov/3e7u.psicov.rr >> ./predictions/3e7u.psicov.rr]] [[Executing: echo "GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY" > ./predictions/dncon2.rr]] [[Executing: cat ./3e7u.rr.raw >> ./predictions/dncon2.rr]] Add some details to the prediction and prepared CASP RR format.. Checking ./predictions/dncon2.rr GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY 1 2 0 8 0.86496 sequence: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY Finished [../scripts/dncon2-main.pl]: Tue May 7 15:50:15 2019