/* i/o of multiple sequence alignment files in Clustal-like formats * * Contents: * 1. API for reading/writing Clustal and Clustal-like formats * 2. Internal routines for Clustal formats. * 3. Unit tests. * 4. Test driver. * 5. Example. * 6. Copyright and license information. * * This module is responsible for i/o of both eslMSAFILE_CLUSTAL and * eslMSAFILE_CLUSTALLIKE alignment formats. */ #include "esl_config.h" #include #include #include #include #include "easel.h" #ifdef eslAUGMENT_ALPHABET #include "esl_alphabet.h" #endif #include "esl_mem.h" #include "esl_msa.h" #include "esl_msafile.h" #include "esl_msafile_clustal.h" static int make_text_consensus_line(const ESL_MSA *msa, char **ret_consline); #ifdef eslAUGMENT_ALPHABET static int make_digital_consensus_line(const ESL_MSA *msa, char **ret_consline); #endif /***************************************************************** *# 1. API for reading/writing Clustal and Clustal-like formats *****************************************************************/ /* Function: esl_msafile_clustal_SetInmap() * Synopsis: Configure input map for CLUSTAL, CLUSTALLIKE formats. * * Purpose: Set the inmap> for Clustal-like formats. * * Text mode accepts any character. * Digital mode enforces the usual Easel alphabets. */ int esl_msafile_clustal_SetInmap(ESLX_MSAFILE *afp) { int sym; #ifdef eslAUGMENT_ALPHABET if (afp->abc) { for (sym = 0; sym < 128; sym++) afp->inmap[sym] = afp->abc->inmap[sym]; afp->inmap[0] = esl_abc_XGetUnknown(afp->abc); } #endif if (! afp->abc) { for (sym = 1; sym < 128; sym++) afp->inmap[sym] = (isgraph(sym) ? sym : eslDSQ_ILLEGAL); afp->inmap[0] = '?'; } return eslOK; } /* Function: esl_msafile_clustal_GuessAlphabet() * Synopsis: Guess the alphabet of an open Clustal MSA input. * * Purpose: Guess the alpbabet of the sequences in open * Clustal format MSA file . * * On a normal return, <*ret_type> is set to , * , or , and is reset to its * original position. * * Args: afp - open Clustal format MSA file * ret_type - RETURN: , , or * * Returns: on success. * if alphabet type can't be determined. * In either case, is rewound to the position it * started at. * * Throws: on allocation error. * on failures of fread() or other system calls */ int esl_msafile_clustal_GuessAlphabet(ESLX_MSAFILE *afp, int *ret_type) { int alphatype = eslUNKNOWN; esl_pos_t anchor = -1; int threshold[3] = { 500, 5000, 50000 }; /* we check after 500, 5000, 50000 residues; else we go to EOF */ int nsteps = 3; int step = 0; int nres = 0; int x; int64_t ct[26]; char *p, *tok; esl_pos_t n, toklen, pos; int status; for (x = 0; x < 26; x++) ct[x] = 0; anchor = esl_buffer_GetOffset(afp->bf); if ((status = esl_buffer_SetAnchor(afp->bf, anchor)) != eslOK) { status = eslEINCONCEIVABLE; goto ERROR; } /* [eslINVAL] can't happen here */ /* Ignore the first nonblank line, which says "CLUSTAL W (1.83) multiple sequence alignment" or some such */ while ( (status = esl_buffer_GetLine(afp->bf, &p, &n)) == eslOK && esl_memspn(p, n, " \t") == n) ; if (status == eslEOF) ESL_XFAIL(eslENOALPHABET, afp->errmsg, "can't determine alphabet: no alignment data found"); else if (status != eslOK) goto ERROR; while ( (status = esl_buffer_GetLine(afp->bf, &p, &n)) == eslOK) { if ((status = esl_memtok(&p, &n, " \t", &tok, &toklen)) != eslOK) continue; /* ignore blank lines */ /* p now points to the rest of the sequence line, after a name */ /* count characters into ct[] array */ for (pos = 0; pos < n; pos++) if (isalpha(p[pos])) { x = toupper(p[pos]) - 'A'; ct[x]++; nres++; } /* try to stop early, checking after 500, 5000, and 50000 residues: */ if (step < nsteps && nres > threshold[step]) { if ((status = esl_abc_GuessAlphabet(ct, &alphatype)) == eslOK) goto DONE; /* (eslENOALPHABET) */ step++; } } if (status != eslEOF) goto ERROR; /* [eslEMEM,eslESYS,eslEINCONCEIVABLE] */ status = esl_abc_GuessAlphabet(ct, &alphatype); /* (eslENOALPHABET) */ DONE: esl_buffer_SetOffset(afp->bf, anchor); /* Rewind to where we were. */ esl_buffer_RaiseAnchor(afp->bf, anchor); *ret_type = alphatype; return status; ERROR: if (anchor != -1) { esl_buffer_SetOffset(afp->bf, anchor); esl_buffer_RaiseAnchor(afp->bf, anchor); } *ret_type = eslUNKNOWN; return status; } /* Function: esl_msafile_clustal_Read() * Synopsis: Read in a CLUSTAL or CLUSTALLIKE alignment. * * Purpose: Read an MSA from an open , parsing * for Clustal or Clustal-like format, starting from the * current point. (format> is expected to be * or .) Create a * new multiple alignment, and return a ptr to that * alignment in <*ret_msa>. Caller is responsible for * free'ing this . * * Args: afp - open * ret_msa - RETURN: newly parsed * * Returns: on success. * * if no (more) alignment data are found in * , and is returned at EOF. * * on a parse error. <*ret_msa> is set to * . contains information sufficient for * constructing useful diagnostic output: * | errmsg> | user-directed error message | * | linenumber> | line # where error was detected | * | line> | offending line (not NUL-term) | * | n> | length of offending line | * | bf->filename> | name of the file | * and is poised at the start of the following line, * so (in principle) the caller could try to resume * parsing. * * Throws: - an allocation failed. * - a system call such as fread() failed * - "impossible" corruption */ int esl_msafile_clustal_Read(ESLX_MSAFILE *afp, ESL_MSA **ret_msa) { ESL_MSA *msa = NULL; char *p = NULL; esl_pos_t n = 0; char *tok = NULL; esl_pos_t ntok = 0; int nblocks = 0; int idx = 0; int nseq = 0; int64_t alen = 0; int64_t cur_alen; esl_pos_t pos; esl_pos_t name_start, name_len; esl_pos_t seq_start, seq_len; esl_pos_t block_seq_start, block_seq_len; int status; ESL_DASSERT1( (afp->format == eslMSAFILE_CLUSTAL || afp->format == eslMSAFILE_CLUSTALLIKE) ); afp->errmsg[0] = '\0'; #ifdef eslAUGMENT_ALPHABET if (afp->abc && (msa = esl_msa_CreateDigital(afp->abc, 16, -1)) == NULL) { status = eslEMEM; goto ERROR; } #endif if (! afp->abc && (msa = esl_msa_Create( 16, -1)) == NULL) { status = eslEMEM; goto ERROR; } /* skip leading blank lines in file */ while ( (status = eslx_msafile_GetLine(afp, &p, &n)) == eslOK && esl_memspn(afp->line, afp->n, " \t") == afp->n) ; if (status != eslOK) goto ERROR; /* includes normal EOF */ /* That first line says something like: "CLUSTAL W (1.83) multiple sequence alignment" */ if (esl_memtok(&p, &n, " \t", &tok, &ntok) != eslOK) ESL_XFAIL(eslEFORMAT, afp->errmsg, "missing CLUSTAL header"); if (afp->format == eslMSAFILE_CLUSTAL && ! esl_memstrpfx(tok, ntok, "CLUSTAL")) ESL_XFAIL(eslEFORMAT, afp->errmsg, "missing CLUSTAL header"); if (! esl_memstrcontains(p, n, "multiple sequence alignment")) ESL_XFAIL(eslEFORMAT, afp->errmsg, "missing CLUSTAL header"); /* skip blank lines again */ do { status = eslx_msafile_GetLine(afp, &p, &n); if (status == eslEOF) ESL_XFAIL(eslEFORMAT, afp->errmsg, "no alignment data following header"); else if (status != eslOK) goto ERROR; } while (esl_memspn(afp->line, afp->n, " \t") == afp->n); /* idiom for "blank line" */ /* Read the file a line at a time. */ do { /* afp->line, afp->n is now the first line of a block... */ idx = 0; do { for (pos = 0; pos < n; pos++) if (! isspace(p[pos])) break; name_start = pos; for (pos = pos+1; pos < n; pos++) if ( isspace(p[pos])) break; name_len = pos - name_start; for (pos = pos+1; pos < n; pos++) if (! isspace(p[pos])) break; seq_start = pos; if (pos >= n) ESL_XFAIL(eslEFORMAT, afp->errmsg, "invalid alignment line"); for (pos = n-1; pos > 0; pos--) if (! isspace(p[pos])) break; seq_len = pos - seq_start + 1; if (idx == 0) { block_seq_start = seq_start; block_seq_len = seq_len; } else { if (seq_start != block_seq_start) ESL_XFAIL(eslEFORMAT, afp->errmsg, "sequence start is misaligned"); if (seq_len != block_seq_len) ESL_XFAIL(eslEFORMAT, afp->errmsg, "sequence end is misaligned"); } /* Store the sequence name. */ if (nblocks == 0) { /* make sure we have room for another sequence */ if (idx >= msa->sqalloc && (status = esl_msa_Expand(msa)) != eslOK) goto ERROR; if ( (status = esl_msa_SetSeqName(msa, idx, p+name_start, name_len)) != eslOK) goto ERROR; nseq++; } else { if (! esl_memstrcmp(p+name_start, name_len, msa->sqname[idx])) ESL_XFAIL(eslEFORMAT, afp->errmsg, "expected sequence %s on this line, but saw %.*s", msa->sqname[idx], (int) name_len, p+name_start); } /* Append the sequence. */ cur_alen = alen; #ifdef eslAUGMENT_ALPHABET if (msa->abc) { status = esl_abc_dsqcat(afp->inmap, &(msa->ax[idx]), &(cur_alen), p+seq_start, seq_len); } #endif if (! msa->abc) { status = esl_strmapcat (afp->inmap, &(msa->aseq[idx]), &(cur_alen), p+seq_start, seq_len); } if (status == eslEINVAL) ESL_XFAIL(eslEFORMAT, afp->errmsg, "one or more invalid sequence characters"); else if (status != eslOK) goto ERROR; if (cur_alen - alen != seq_len) ESL_XFAIL(eslEFORMAT, afp->errmsg, "unexpected number of seq characters"); /* get next line. if it's a consensus line, we're done with the block */ status = eslx_msafile_GetLine(afp, &p, &n); if (status == eslEOF) ESL_XFAIL(eslEFORMAT, afp->errmsg, "alignment block did not end with consensus line"); else if (status != eslOK) goto ERROR; idx++; } while (esl_memspn(afp->line, afp->n, " .:*") < afp->n); /* end loop over a block */ if (idx != nseq) ESL_XFAIL(eslEFORMAT, afp->errmsg, "last block didn't contain same # of seqs as earlier blocks"); /* skip blank lines until we find start of next block, or EOF */ do { status = eslx_msafile_GetLine(afp, &p, &n); if (status == eslEOF) break; else if (status != eslOK) goto ERROR; } while (esl_memspn(p, n, " \t") == n); alen += block_seq_len; nblocks++; } while (status == eslOK); /* normal end has status == EOF after last block. */ msa->nseq = nseq; msa->alen = alen; if (( status = esl_msa_SetDefaultWeights(msa)) != eslOK) goto ERROR; *ret_msa = msa; return eslOK; ERROR: if (msa) esl_msa_Destroy(msa); *ret_msa = NULL; return status; } /* Function: esl_msafile_clustal_Write() * Synopsis: Write a CLUSTAL format alignment file to a stream. * * Purpose: Write alignment to output stream , in * format . If is , * write strict CLUSTAL 2.1 format. If * is , put "EASEL (VERSION)" * in the header. * * The alignment is written in blocks of 60 aligned * residues at a time. * * Constructing the CLUSTAL consensus line properly * requires knowing the alphabet. If the is in text * mode, we don't know the alphabet, so then we use a * simplified consensus line, with '*' marking completely * conserved columns, ' ' on everything else. If the * is in digital mode and of type , then we also * use Clustal's "strong" and "weak" residue group * annotations, ':' and '.'. Strong groups are STA, NEQK, * NHQK, NDEQ, QHRK, MILV, MILF, HY, and FYW. Weak groups * are CSA, ATV, SAG, STNK, STPA, SGND, SNDEQK, NDEQHK, * NEQHRK, FVLIM, and HFY. * * Args: fp - open output stream, writable * msa - alignment to write * fmt - eslMSAFILE_CLUSTAL or eslMSAFILE_CLUSTALLIKE * * Returns: on success. * * Throws: on allocation error. * on any system write error, such as filled disk. */ int esl_msafile_clustal_Write(FILE *fp, const ESL_MSA *msa, int fmt) { int cpl = 60; int maxnamelen = 0; int namelen; char *consline = NULL; char *buf = NULL; int64_t apos; int i; int status; ESL_ALLOC(buf, sizeof(char) * (cpl+1)); buf[cpl] = '\0'; for (i = 0; i < msa->nseq; i++) { namelen = strlen(msa->sqname[i]); maxnamelen = ESL_MAX(namelen, maxnamelen); } /* Make a CLUSTAL-like consensus line */ #ifdef eslAUGMENT_ALPHABET // if (msa->abc && (status = make_digital_consensus_line(msa, &consline)) != eslOK) goto ERROR; if (msa->abc && (status = make_digital_consensus_line(msa, &consline)) != eslOK) goto ERROR; #endif if (! msa->abc && (status = make_text_consensus_line(msa, &consline)) != eslOK) goto ERROR; /* The magic header */ if (fmt == eslMSAFILE_CLUSTAL) { if (fprintf(fp, "CLUSTAL 2.1 multiple sequence alignment\n") < 0) ESL_XEXCEPTION_SYS(eslEWRITE, "clustal msa write failed"); } else if (fmt == eslMSAFILE_CLUSTALLIKE) { if (fprintf(fp, "EASEL (%s) multiple sequence alignment\n", EASEL_VERSION) < 0) ESL_XEXCEPTION_SYS(eslEWRITE, "clustal msa write failed"); } /* The alignment */ for (apos = 0; apos < msa->alen; apos += cpl) { if (fprintf(fp, "\n") < 0) ESL_XEXCEPTION_SYS(eslEWRITE, "clustal msa write failed"); for (i = 0; i < msa->nseq; i++) { #ifdef eslAUGMENT_ALPHABET if (msa->abc) esl_abc_TextizeN(msa->abc, msa->ax[i]+apos+1, cpl, buf); #endif if (! msa->abc) strncpy(buf, msa->aseq[i]+apos, cpl); if (fprintf(fp, "%-*s %s\n", maxnamelen, msa->sqname[i], buf) < 0) ESL_XEXCEPTION_SYS(eslEWRITE, "clustal msa write failed"); } strncpy(buf, consline+apos, cpl); if (fprintf(fp, "%-*s %s\n", maxnamelen, "", buf) < 0) ESL_XEXCEPTION_SYS(eslEWRITE, "clustal msa write failed"); } free(buf); free(consline); return eslOK; ERROR: if (buf) free(buf); if (consline) free(consline); return status; } /*---------------- end, Clustal API -----------------------------*/ /***************************************************************** * 2. Internal routines for Clustal formats *****************************************************************/ /* Clustal consensus lines. * '*' : 100% conserved positions * ':' : all residues in column belong to a "strong group" * '.' : all residues in column belong to a "weak group" * ' ' : otherwise * * Gap characters count, and ambiguity codes are interpreted verbatim, * so even a single gap or ambiguity code makes the column a ' '. * * From examining the source code for ClustalW (as it writes its * "self explanatory format", ahem!): * strong groups = STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, * HY, FYW * weak groups = CSA, ATV, SAG, STNK, STPA, SGND, SNDEQK, * NDEQHK, NEQHRK, FVLIM, HFY * * These groups only apply to protein data, and therefore only to * digital alignments using an alphabet. * Calculating the consensus line can be compute-intensive, for large * alignments. A naive implementation (for each column, collect * residue counts, compare to each conservation group) was judged too * slow: 16.2s to write the Pkinase full alignment, compared to 1.5s * to write Stockholm format [SRE:J8/22]. Here we use a slightly less * naive implementation, which collects a bit vector (one bit per * residue) for each column, and traverses the alignment in stride * (sequences, then columns). Writing Clustal format Pkinase now takes * 2.3s, and most of the difference w.r.t. Stockholm is now assignable * to the smaller width (thus greater number of blocks) written for * Clustal (60 cpl vs 200) rather than to consensus construction. * * An oversophisticated approach could use a finite * automaton to store all groups in one machine, then to use the FA to * process each residue seen in a column; for most columns, we would * quickly reach a rejection state (most columns don't belong to * a conservation group, especially in large alignments). For a sketch * of how to construct and use such an automaton, xref SRE:J8/22. * I decided this was probably overkill, and didn't implement it. */ /* make_text_consensus_line() * * Given a text mode , allocate and create a CLUSTAL-style * consensus line; return it in <*ret_consline>. Caller is responsible * for free'ing this string. * * In text mode, we don't know the alphabet; in particular, we can't * know if the data are amino acids, so we don't know if it's * appropriate to use the amino acid group codes. So we don't; * in text mode, only '*' and ' ' appear in consensus lines. * * The consensus line is numbered 0..alen-1, and is NUL-terminated. * * Returns on success. * No normal failure codes. * Throws on allocation error. */ static int make_text_consensus_line(const ESL_MSA *msa, char **ret_consline) { char *consline = NULL; uint32_t *v = NULL; uint32_t tmpv, maxv; int n; int idx, apos, x; int status; ESL_ALLOC(consline, sizeof(char) * (msa->alen+1)); ESL_ALLOC(v, sizeof(uint32_t) * (msa->alen)); for (apos = 0; apos < msa->alen; apos++) v[apos] = 0; for (idx = 0; idx < msa->nseq; idx++) for (apos = 0; apos < msa->alen; apos++) { x = toupper(msa->aseq[idx][apos]) - 'A'; if (x >= 0 && x < 26) v[apos] |= (1 << x); else v[apos] |= (1 << 26); } maxv = (1 << 26) - 1; for (apos = 0; apos < msa->alen; apos++) { for (n = 0, tmpv = v[apos]; tmpv; n++) tmpv &= tmpv-1; /* Kernighan magic: count # of bits set in tmpv */ consline[apos] = ((n == 1 && v[apos] < maxv) ? '*' : ' '); } consline[msa->alen] = '\0'; *ret_consline = consline; free(v); return eslOK; ERROR: if (v) free(v); if (consline) free(consline); *ret_consline = NULL; return status; } /* make_digital_consensus_line() * * Exactly the same as make_text_consensus_line(), except for * digital mode . */ #ifdef eslAUGMENT_ALPHABET static int matches_group_digital(ESL_ALPHABET *abc, uint32_t v, char *group) { uint32_t gv = 0; ESL_DSQ sym; char *c; for (c = group; *c; c++) { sym = esl_abc_DigitizeSymbol(abc, *c); gv |= (1 << sym); } return ( ((v & gv) == v) ? TRUE : FALSE); } static int make_digital_consensus_line(const ESL_MSA *msa, char **ret_consline) { char *consline = NULL; uint32_t *v = NULL; uint32_t tmpv, maxv; int n; int idx, apos; int status; /* if this ever becomes a problem, easy enough to make v a uint64_t to get up to Kp<=64 */ if (msa->abc->Kp > 32) ESL_EXCEPTION(eslEINVAL, "Clustal format writer cannot handle digital alphabets of Kp>32 residues"); ESL_ALLOC(v, sizeof(uint32_t) * (msa->alen+1)); ESL_ALLOC(consline, sizeof(char) * (msa->alen+1)); for (apos = 0; apos <= msa->alen; apos++) v[apos] = 0; for (idx = 0; idx < msa->nseq; idx++) for (apos = 1; apos <= msa->alen; apos++) v[apos] |= (1 << msa->ax[idx][apos]); maxv = (1 << msa->abc->K) - 1; /* maxv: has all canonical residue bits set */ for (apos = 1; apos <= msa->alen; apos++) { consline[apos-1] = ' '; for (n = 0, tmpv = v[apos]; tmpv; n++) tmpv &= tmpv-1; /* Kernighan magic: count # of bits set in tmpv */ if (n == 0 || n > 6) continue; /* n==0 shouldn't happen; n > 6 means too many different residues seen */ else if (v[apos] > maxv) continue; /* gap or ambiguity chars seen; column must be left unannotated */ else if (n == 1) consline[apos-1] = '*'; /* complete conservation of a canonical residue */ else if (msa->abc->type == eslAMINO) { if (matches_group_digital(msa->abc, v[apos], "STA")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "NEQK")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "NHQK")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "NDEQ")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "QHRK")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "MILV")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "MILF")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "HY")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "FYW")) consline[apos-1] = ':'; else if (matches_group_digital(msa->abc, v[apos], "CSA")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "ATV")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "SAG")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "STNK")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "STPA")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "SGND")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "SNDEQK")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "NDEQHK")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "NEQHRK")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "FVLIM")) consline[apos-1] = '.'; else if (matches_group_digital(msa->abc, v[apos], "HFY")) consline[apos-1] = '.'; } } consline[apos-1] = '\0'; *ret_consline = consline; free(v); return eslOK; ERROR: if (v) free(v); if (consline) free(consline); *ret_consline = NULL; return eslOK; } #endif /*eslAUGMENT_ALPHABET*/ /*-------------- end, internal clustal routines -----------------*/ /***************************************************************** * 3. Unit tests. *****************************************************************/ #ifdef eslMSAFILE_CLUSTAL_TESTDRIVE static void utest_write_good1(FILE *ofp, int *ret_format, int *ret_alphatype, int *ret_nseq, int *ret_alen) { fputs("MUSCLE (3.7) multiple sequence alignment\n", ofp); fputs("\n", ofp); fputs("\n", ofp); fputs("MYG_PHYCA --------V-LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKT\n", ofp); fputs("GLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLTT\n", ofp); fputs("HBB_HUMAN --------VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLST\n", ofp); fputs("HBA_HUMAN --------V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-----\n", ofp); fputs(" . *: :. : *. * * : * .:: * : * * \n", ofp); fputs("\n", ofp); fputs("MYG_PHYCA EAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFIS\n", ofp); fputs("GLB5_PETMA ADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLA\n", ofp); fputs("HBB_HUMAN PDAVMGNPKVKAHGKKVLGAFSDGLAHLDN---LKGTFATLSELHCDKLHVDPENFRLLG\n", ofp); fputs("HBA_HUMAN -DLSHGSAQVKGHGKKVADALTNAVAHVDD---MPNALSALSDLHAHKLRVDPVNFKLLS\n", ofp); fputs(" \n", ofp); /* deliberately made blank */ fputs("\n", ofp); fputs("MYG_PHYCA EAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG\n", ofp); fputs("GLB5_PETMA AVI---------ADTVAAGDAGFEKLMSMICILLRSAY-------\n", ofp); fputs("HBB_HUMAN NVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH------\n", ofp); fputs("HBA_HUMAN HCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR------\n", ofp); fputs(" : : . .. :* : . : * \n", ofp); fputs("\n", ofp); *ret_format = eslMSAFILE_CLUSTALLIKE; *ret_alphatype = eslAMINO; *ret_nseq = 4; *ret_alen = 165; } static void utest_write_good2(FILE *ofp, int *ret_format, int *ret_alphatype, int *ret_nseq, int *ret_alen) { fputs("CLUSTAL W (1.81) multiple sequence alignment\n", ofp); fputs("\n", ofp); fputs("tRNA2 UCCGAUAUAGUGUAACGGCUAUCACAUCACGCUUUCACCGUGG-AGACCGGGGUUCGACU\n", ofp); fputs("tRNA3 UCCGUGAUAGUUUAAUGGUCAGAAUGG-GCGCUUGUCGCGUGCCAGAUCGGGGUUCAAUU\n", ofp); fputs("tRNA5 GGGCACAUGGCGCAGUUGGUAGCGCGCUUCCCUUGCAAGGAAGAGGUCAUCGGUUCGAUU\n", ofp); fputs("tRNA1 GCGGAUUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAUCUGGAGGUCCUGUGUUCGAUC\n", ofp); fputs("tRNA4 GCUCGUAUGGCGCAGUGG-UAGCGCAGCAGAUUGCAAAUCUGUUGGUCCUUAGUUCGAUC\n", ofp); fputs(" * * * * * * * **** * \n", ofp); fputs("\n", ofp); fputs("tRNA2 CCCCGUAUCGGAG\n", ofp); fputs("tRNA3 CCCCGUCGCGGAG\n", ofp); fputs("tRNA5 CCGGUUGCGUCCA\n", ofp); fputs("tRNA1 CACAGAAUUCGCA\n", ofp); fputs("tRNA4 CUGAGUGCGAGCU\n", ofp); fputs(" * \n", ofp); *ret_format = eslMSAFILE_CLUSTAL; *ret_alphatype = eslRNA; *ret_nseq = 5; *ret_alen = 73; } static void utest_goodfile(char *filename, int testnumber, int expected_format, int expected_alphatype, int expected_nseq, int expected_alen) { ESL_ALPHABET *abc = NULL; ESLX_MSAFILE *afp = NULL; ESL_MSA *msa1 = NULL; ESL_MSA *msa2 = NULL; char tmpfile1[32] = "esltmpXXXXXX"; char tmpfile2[32] = "esltmpXXXXXX"; FILE *ofp = NULL; int status; /* guessing both the format and the alphabet should work: this is a digital open */ if ( (status = eslx_msafile_Open(&abc, filename, NULL, eslMSAFILE_UNKNOWN, NULL, &afp)) != eslOK) esl_fatal("clustal good file test %d failed: digital open", testnumber); if (afp->format != expected_format) esl_fatal("clustal good file test %d failed: format autodetection", testnumber); if (abc->type != expected_alphatype) esl_fatal("clustal good file test %d failed: alphabet autodetection", testnumber); /* This is a digital read, using . */ if ( (status = esl_msafile_clustal_Read(afp, &msa1)) != eslOK) esl_fatal("clustal good file test %d failed: msa read, digital", testnumber); if (msa1->nseq != expected_nseq || msa1->alen != expected_alen) esl_fatal("clustal good file test %d failed: nseq/alen", testnumber); if (esl_msa_Validate(msa1, NULL) != eslOK) esl_fatal("clustal good file test %d failed: msa1 invalid", testnumber); eslx_msafile_Close(afp); /* write it back out to a new tmpfile (digital write) */ if ( (status = esl_tmpfile_named(tmpfile1, &ofp)) != eslOK) esl_fatal("clustal good file test %d failed: tmpfile creation", testnumber); if ( (status = esl_msafile_clustal_Write(ofp, msa1, expected_format)) != eslOK) esl_fatal("clustal good file test %d failed: msa write, digital", testnumber); fclose(ofp); /* now open and read it as text mode, in known format. (We have to pass fmtd now, to deal with the possibility of a nonstandard name width) */ if ( (status = eslx_msafile_Open(NULL, tmpfile1, NULL, expected_format, NULL, &afp)) != eslOK) esl_fatal("clustal good file test %d failed: text mode open", testnumber); if ( (status = esl_msafile_clustal_Read(afp, &msa2)) != eslOK) esl_fatal("clustal good file test %d failed: msa read, text", testnumber); if (msa2->nseq != expected_nseq || msa2->alen != expected_alen) esl_fatal("clustal good file test %d failed: nseq/alen", testnumber); if (esl_msa_Validate(msa2, NULL) != eslOK) esl_fatal("clustal good file test %d failed: msa2 invalid", testnumber); eslx_msafile_Close(afp); /* write it back out to a new tmpfile (text write) */ if ( (status = esl_tmpfile_named(tmpfile2, &ofp)) != eslOK) esl_fatal("clustal good file test %d failed: tmpfile creation", testnumber); if ( (status = esl_msafile_clustal_Write(ofp, msa2, expected_format)) != eslOK) esl_fatal("clustal good file test %d failed: msa write, text", testnumber); fclose(ofp); esl_msa_Destroy(msa2); /* open and read it in digital mode */ if ( (status = eslx_msafile_Open(&abc, tmpfile1, NULL, expected_format, NULL, &afp)) != eslOK) esl_fatal("clustal good file test %d failed: 2nd digital mode open", testnumber); if ( (status = esl_msafile_clustal_Read(afp, &msa2)) != eslOK) esl_fatal("clustal good file test %d failed: 2nd digital msa read", testnumber); if (esl_msa_Validate(msa2, NULL) != eslOK) esl_fatal("clustal good file test %d failed: msa2 invalid", testnumber); eslx_msafile_Close(afp); /* this msa should be identical to */ if (esl_msa_Compare(msa1, msa2) != eslOK) esl_fatal("clustal good file test %d failed: msa compare", testnumber); remove(tmpfile1); remove(tmpfile2); esl_msa_Destroy(msa1); esl_msa_Destroy(msa2); esl_alphabet_Destroy(abc); } static void write_test_msas(FILE *ofp1, FILE *ofp2) { fprintf(ofp1, "EASEL (X.x) multiple sequence alignment\n"); fprintf(ofp1, "\n"); fprintf(ofp1, "seq1 ..acdefghiklmnpqrstvwy\n"); fprintf(ofp1, "seq2 ..acdefghiklmnpqrstv--\n"); fprintf(ofp1, "seq3 aaacdefghiklmnpqrstv--\n"); fprintf(ofp1, "seq4 ..acdefghiklmnpqrstvwy\n"); fprintf(ofp1, " ****************** \n"); fprintf(ofp1, "\n"); fprintf(ofp1, "seq1 ACDEFGHIKLMNPQRSTVWY\n"); fprintf(ofp1, "seq2 ACDEFGHIKLMNPQRSTVWY\n"); fprintf(ofp1, "seq3 ACDEFGHIKLMNPQRSTVWY\n"); fprintf(ofp1, "seq4 ACDEFGHIKLMNPQRSTVWY\n"); fprintf(ofp1, " ********************\n"); fprintf(ofp1, "\n"); fprintf(ofp1, "seq1 ..\n"); fprintf(ofp1, "seq2 YY\n"); fprintf(ofp1, "seq3 ..\n"); fprintf(ofp1, "seq4 ..\n"); fprintf(ofp1, "\n"); fprintf(ofp2, "# STOCKHOLM 1.0\n"); fprintf(ofp2, "\n"); fprintf(ofp2, "seq1 ..acdefghiklmnpqrstvwyACDEFGHIKLMNPQRSTVWY..\n"); fprintf(ofp2, "seq2 ..acdefghiklmnpqrstv--ACDEFGHIKLMNPQRSTVWYYY\n"); fprintf(ofp2, "seq3 aaacdefghiklmnpqrstv--ACDEFGHIKLMNPQRSTVWY..\n"); fprintf(ofp2, "seq4 ..acdefghiklmnpqrstvwyACDEFGHIKLMNPQRSTVWY..\n"); fprintf(ofp2, "//\n"); } static void read_test_msas_digital(char *alnfile, char *stkfile) { char msg[] = "CLUSTAL msa digital read unit test failed"; ESL_ALPHABET *abc = NULL; ESLX_MSAFILE *afp1 = NULL; ESLX_MSAFILE *afp2 = NULL; ESL_MSA *msa1, *msa2, *msa3, *msa4; FILE *alnfp, *stkfp; char alnfile2[32] = "esltmpaln2XXXXXX"; char stkfile2[32] = "esltmpstk2XXXXXX"; if ( eslx_msafile_Open(&abc, alnfile, NULL, eslMSAFILE_CLUSTALLIKE, NULL, &afp1) != eslOK) esl_fatal(msg); if ( !abc || abc->type != eslAMINO) esl_fatal(msg); if ( eslx_msafile_Open(&abc, stkfile, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Read (afp1, &msa1) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa2) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa1, msa2) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Read (afp1, &msa3) != eslEOF) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa3) != eslEOF) esl_fatal(msg); eslx_msafile_Close(afp2); eslx_msafile_Close(afp1); /* Now write stk to clustal file, and vice versa; then retest */ if ( esl_tmpfile_named(alnfile2, &alnfp) != eslOK) esl_fatal(msg); if ( esl_tmpfile_named(stkfile2, &stkfp) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Write (alnfp, msa2, eslMSAFILE_CLUSTAL) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Write(stkfp, msa1, eslMSAFILE_STOCKHOLM) != eslOK) esl_fatal(msg); fclose(alnfp); fclose(stkfp); if ( eslx_msafile_Open(&abc, alnfile2, NULL, eslMSAFILE_CLUSTAL, NULL, &afp1) != eslOK) esl_fatal(msg); if ( eslx_msafile_Open(&abc, stkfile2, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Read (afp1, &msa3) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa4) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa3, msa4) != eslOK) esl_fatal(msg); remove(alnfile2); remove(stkfile2); eslx_msafile_Close(afp2); eslx_msafile_Close(afp1); esl_msa_Destroy(msa1); esl_msa_Destroy(msa2); esl_msa_Destroy(msa3); esl_msa_Destroy(msa4); esl_alphabet_Destroy(abc); } static void read_test_msas_text(char *alnfile, char *stkfile) { char msg[] = "CLUSTAL msa text-mode read unit test failed"; ESLX_MSAFILE *afp1 = NULL; ESLX_MSAFILE *afp2 = NULL; ESL_MSA *msa1, *msa2, *msa3, *msa4; FILE *alnfp, *stkfp; char alnfile2[32] = "esltmpaln2XXXXXX"; char stkfile2[32] = "esltmpstk2XXXXXX"; /* vvvv-- everything's the same as the digital utest except these NULLs */ if ( eslx_msafile_Open(NULL, alnfile, NULL, eslMSAFILE_CLUSTALLIKE, NULL, &afp1) != eslOK) esl_fatal(msg); if ( eslx_msafile_Open(NULL, stkfile, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Read (afp1, &msa1) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa2) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa1, msa2) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Read (afp1, &msa3) != eslEOF) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa3) != eslEOF) esl_fatal(msg); eslx_msafile_Close(afp2); eslx_msafile_Close(afp1); if ( esl_tmpfile_named(alnfile2, &alnfp) != eslOK) esl_fatal(msg); if ( esl_tmpfile_named(stkfile2, &stkfp) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Write (alnfp, msa2, eslMSAFILE_CLUSTAL) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Write(stkfp, msa1, eslMSAFILE_STOCKHOLM) != eslOK) esl_fatal(msg); fclose(alnfp); fclose(stkfp); if ( eslx_msafile_Open(NULL, alnfile2, NULL, eslMSAFILE_CLUSTAL, NULL, &afp1) != eslOK) esl_fatal(msg); if ( eslx_msafile_Open(NULL, stkfile2, NULL, eslMSAFILE_STOCKHOLM, NULL, &afp2) != eslOK) esl_fatal(msg); if ( esl_msafile_clustal_Read (afp1, &msa3) != eslOK) esl_fatal(msg); if ( esl_msafile_stockholm_Read(afp2, &msa4) != eslOK) esl_fatal(msg); if ( esl_msa_Compare(msa3, msa4) != eslOK) esl_fatal(msg); remove(alnfile2); remove(stkfile2); eslx_msafile_Close(afp2); eslx_msafile_Close(afp1); esl_msa_Destroy(msa1); esl_msa_Destroy(msa2); esl_msa_Destroy(msa3); esl_msa_Destroy(msa4); } #endif /*eslMSAFILE_CLUSTAL_TESTDRIVE*/ /*---------------------- end, unit tests ------------------------*/ /***************************************************************** * 4. Test driver. *****************************************************************/ #ifdef eslMSAFILE_CLUSTAL_TESTDRIVE /* compile: gcc -g -Wall -I. -L. -o esl_msafile_clustal_utest -DeslMSAFILE_CLUSTAL_TESTDRIVE esl_msafile_clustal.c -leasel -lm * (gcov): gcc -g -Wall -fprofile-arcs -ftest-coverage -I. -L. -o esl_msafile_clustal_utest -DeslMSAFILE_CLUSTAL_TESTDRIVE esl_msafile_clustal.c -leasel -lm * run: ./esl_msafile_clustal_utest */ #include "esl_config.h" #include #include "easel.h" #include "esl_getopts.h" #include "esl_random.h" #include "esl_msafile.h" #include "esl_msafile_clustal.h" static ESL_OPTIONS options[] = { /* name type default env range togs reqs incomp help docgrp */ {"-h", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "show help and usage", 0}, { 0,0,0,0,0,0,0,0,0,0}, }; static char usage[] = "[-options]"; static char banner[] = "test driver for CLUSTAL MSA format module"; int main(int argc, char **argv) { char msg[] = "CLUSTAL MSA i/o module test driver failed"; ESL_GETOPTS *go = esl_getopts_CreateDefaultApp(options, 0, argc, argv, banner, usage); char alnfile[32] = "esltmpalnXXXXXX"; char stkfile[32] = "esltmpstkXXXXXX"; FILE *alnfp, *stkfp; int testnumber; int ngoodtests = 2; char tmpfile[32]; FILE *ofp; int expected_format; int expected_alphatype; int expected_nseq; int expected_alen; if ( esl_tmpfile_named(alnfile, &alnfp) != eslOK) esl_fatal(msg); if ( esl_tmpfile_named(stkfile, &stkfp) != eslOK) esl_fatal(msg); write_test_msas(alnfp, stkfp); fclose(alnfp); fclose(stkfp); read_test_msas_digital(alnfile, stkfile); read_test_msas_text (alnfile, stkfile); /* Various "good" files that should be parsed correctly */ for (testnumber = 1; testnumber <= ngoodtests; testnumber++) { strcpy(tmpfile, "esltmpXXXXXX"); if (esl_tmpfile_named(tmpfile, &ofp) != eslOK) esl_fatal(msg); switch (testnumber) { case 1: utest_write_good1 (ofp, &expected_format, &expected_alphatype, &expected_nseq, &expected_alen); break; case 2: utest_write_good2 (ofp, &expected_format, &expected_alphatype, &expected_nseq, &expected_alen); break; } fclose(ofp); utest_goodfile(tmpfile, testnumber, expected_format, expected_alphatype, expected_nseq, expected_alen); remove(tmpfile); } remove(alnfile); remove(stkfile); esl_getopts_Destroy(go); return 0; } #endif /*eslMSAFILE_CLUSTAL_TESTDRIVE*/ /*--------------------- end, test driver ------------------------*/ /***************************************************************** * 5. Examples. *****************************************************************/ #ifdef eslMSAFILE_CLUSTAL_EXAMPLE /* A full-featured example of reading/writing an MSA in Clustal format(s). gcc -g -Wall -o esl_msafile_clustal_example -I. -L. -DeslMSAFILE_CLUSTAL_EXAMPLE esl_msafile_clustal.c -leasel -lm ./esl_msafile_clustal_example */ /*::cexcerpt::msafile_clustal_example::begin::*/ #include #include "easel.h" #include "esl_alphabet.h" #include "esl_getopts.h" #include "esl_msa.h" #include "esl_msafile.h" #include "esl_msafile_clustal.h" static ESL_OPTIONS options[] = { /* name type default env range toggles reqs incomp help docgroup*/ { "-h", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "show brief help on version and usage", 0 }, { "-1", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "no autodetection; use CLUSTAL format", 0 }, { "-2", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "no autodetection; use CLUSTALLIKE format", 0 }, { "-q", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "quieter: don't write msa back, just summary", 0 }, { "-t", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, NULL, "use text mode: no digital alphabet", 0 }, { "--dna", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, "-t", "specify that alphabet is DNA", 0 }, { "--rna", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, "-t", "specify that alphabet is RNA", 0 }, { "--amino", eslARG_NONE, FALSE, NULL, NULL, NULL, NULL, "-t", "specify that alphabet is protein", 0 }, { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, }; static char usage[] = "[-options] "; static char banner[] = "example of guessing, reading, writing Clustal formats"; int main(int argc, char **argv) { ESL_GETOPTS *go = esl_getopts_CreateDefaultApp(options, 1, argc, argv, banner, usage); char *filename = esl_opt_GetArg(go, 1); int infmt = eslMSAFILE_UNKNOWN; ESL_ALPHABET *abc = NULL; ESLX_MSAFILE *afp = NULL; ESL_MSA *msa = NULL; int status; if (esl_opt_GetBoolean(go, "-1")) infmt = eslMSAFILE_CLUSTAL; else if (esl_opt_GetBoolean(go, "-2")) infmt = eslMSAFILE_CLUSTALLIKE; if (esl_opt_GetBoolean(go, "--rna")) abc = esl_alphabet_Create(eslRNA); else if (esl_opt_GetBoolean(go, "--dna")) abc = esl_alphabet_Create(eslDNA); else if (esl_opt_GetBoolean(go, "--amino")) abc = esl_alphabet_Create(eslAMINO); /* Text mode: pass NULL for alphabet. * Digital mode: pass ptr to expected ESL_ALPHABET; and if abc=NULL, alphabet is guessed */ if (esl_opt_GetBoolean(go, "-t")) status = eslx_msafile_Open(NULL, filename, NULL, infmt, NULL, &afp); else status = eslx_msafile_Open(&abc, filename, NULL, infmt, NULL, &afp); if (status != eslOK) eslx_msafile_OpenFailure(afp, status); if ( (status = esl_msafile_clustal_Read(afp, &msa)) != eslOK) eslx_msafile_ReadFailure(afp, status); printf("format variant: %s\n", eslx_msafile_DecodeFormat(afp->format)); printf("alphabet: %s\n", (abc ? esl_abc_DecodeType(abc->type) : "none (text mode)")); printf("# of seqs: %d\n", msa->nseq); printf("# of cols: %d\n", (int) msa->alen); printf("\n"); if (! esl_opt_GetBoolean(go, "-q")) esl_msafile_clustal_Write(stdout, msa, eslMSAFILE_CLUSTAL); esl_msa_Destroy(msa); eslx_msafile_Close(afp); if (abc) esl_alphabet_Destroy(abc); esl_getopts_Destroy(go); exit(0); } /*::cexcerpt::msafile_clustal_example::end::*/ #endif /*eslMSAFILE_CLUSTAL_EXAMPLE*/ #ifdef eslMSAFILE_CLUSTAL_EXAMPLE2 /* A minimal example. Read Clustal MSA, in text mode. gcc -g -Wall -o esl_msafile_clustal_example2 -I. -L. -DeslMSAFILE_CLUSTAL_EXAMPLE2 esl_msafile_clustal.c -leasel -lm ./esl_msafile_clustal_example2 */ /*::cexcerpt::msafile_clustal_example2::begin::*/ #include #include "easel.h" #include "esl_msa.h" #include "esl_msafile.h" #include "esl_msafile_clustal.h" int main(int argc, char **argv) { char *filename = argv[1]; int fmt = eslMSAFILE_CLUSTAL; /* or eslMSAFILE_CLUSTALLIKE */ ESLX_MSAFILE *afp = NULL; ESL_MSA *msa = NULL; int status; if ( (status = eslx_msafile_Open(NULL, filename, NULL, fmt, NULL, &afp)) != eslOK) eslx_msafile_OpenFailure(afp, status); if ( (status = esl_msafile_clustal_Read(afp, &msa)) != eslOK) eslx_msafile_ReadFailure(afp, status); printf("%6d seqs, %5d columns\n", msa->nseq, (int) msa->alen); esl_msafile_clustal_Write(stdout, msa, eslMSAFILE_CLUSTAL); esl_msa_Destroy(msa); eslx_msafile_Close(afp); exit(0); } /*::cexcerpt::msafile_clustal_example2::end::*/ #endif /*eslMSAFILE_CLUSTAL_EXAMPLE2*/ /*--------------------- end of example --------------------------*/ /***************************************************************** * Easel - a library of C functions for biological sequence analysis * Version h3.1b2; February 2015 * Copyright (C) 2015 Howard Hughes Medical Institute. * Other copyrights also apply. See the COPYRIGHT file for a full list. * * Easel is distributed under the Janelia Farm Software License, a BSD * license. See the LICENSE file for more details. * * SVN $Id: esl_msafile_clustal.c 727 2011-10-24 17:17:32Z eddys $ * SVN $URL: https://svn.janelia.org/eddylab/eddys/easel/branches/hmmer/3.1/esl_msafile_clustal.c $ *****************************************************************/