Bioseq-set ::= { level 0 , class genbank , release "66.0" , date str "Apr 30, 1991 11:19 AM" , descr { title "GenBank release 66.0 converted to ASN.1" } , seq-set { seq { id { giim { id 1 } , genbank { name "AGMAPHAAA" , accession "M26844" } } , descr { title "African green monkey alpha-DNA." , genbank { source "African green monkey DNA." , keywords { "alpha DNA" , "alphoid repetitive sequence" } , date "15-DEC-1989" } , org { taxname "Cercopithecus aethiops" } , pub { pub { muid 84259347 , article { title { name "A protein binds to a satellite DNA repeat at three specific sites that would be brought into mutual proximity by DNA folding in the nucleosome" } , authors { names str { "Strauss,F." , "Varshavsky,A." } } , from journal { title { name "Cell" } , imp { date std { year 1984 } , volume "37" , pages "889-901" } } } } } } , inst { repr raw , mol dna , length 208 , topology linear , strand ds , seq-data ncbi2na '0F74EFE127CD36309FDE201EF7BBDEF0F4DD212F137F57E0425FD9C29EF 7EE83E902A33FA055322A73AE00080CDF57D007A0209F00'H } } , set { level 1 , class segset , date str "30-SEP-1988" , descr { title "African green monkey endogenous retroviral 5' LTR, segment 1 of 2." , pub { pub { muid 85295965 , article { title { name "Nucleotide sequence analysis and enhancer function of long terminal repeats associated with an endogenous African green monkey retroviral DNA" } , authors { names str { "Kessel,M." , "Khan,A.S." } } , from journal { title { name "Mol. Cell. Biol." } , imp { date std { year 1985 } , volume "5" , pages "1335-1342" } } } } } , org { taxname "Cercopithecus aethiops" } } , seq-set { seq { id { giim { id 4 } } , descr { title "African green monkey endogenous retroviral 5' LTR, segment 1 of 2." } , inst { repr seg , mol dna , length 1162 , fuzz lim gt , ext seg { whole giim { id 2 } , null NULL , whole giim { id 3 } } } } , set { level 3 , class parts , seq-set { seq { id { giim { id 2 } , genbank { name "AGMERLTR1" , accession "M11391" } } , descr { title "African green monkey endogenous retroviral 5' LTR, segment 1 of 2." , genbank { source "African green monkey DNA." , keywords { "" } , origin "145 bp upstream of HindIII site." } } , inst { repr raw , mol dna , length 612 , topology linear , strand ds , seq-data ncbi2na 'F28B8032944007C807CC87C807C887C807C887C807C887C807C C87C807C887C8874807C809F200944529DC0915950E14AE94DC0915950E14AE94DC09159541B53 BA735004545403D5A0740480042D620316E6AF405070D22C2115E74A5305E750D37E65D09FEE2F DEEBFF97F301EDEC7293DAAD7BA507DA1328572667243037759EE1F5BAD0BADDD9861479528283 7001CAF713FAE47E96A0D69'H } } , seq { id { giim { id 3 } , genbank { name "AGMERLTR2" , accession "M11390" } } , descr { title "African green monkey endogenous retroviral 3' LTR, segment 2 of 2." , genbank { source "African green monkey DNA." , keywords { "" } , origin "131 bp upstream of HindIII site." } } , inst { repr raw , mol dna , length 550 , topology linear , strand ds , seq-data ncbi2na '00228A81E00CA51001F201F321F201F221F201F221F201F221F 201F221D201F2027C8025114A7702456543852BA537024565506D4EE9CD401151500F5681D0120 010B5880C5466BD0141C348B084579D294C179D434DF99742FFB8BF7BAFFE5FCC07B7B1CA4F6AB 5EE941F284CA15C999C90C0DDD67B87D6EB42EB77663855E54A0A0DC0072BD713C120'H } } } } } } , set { level 1 , class nuc-prot , date str "15-JUN-1988" , descr { title "African green monkey BSC-1 cell growth inhibitor, and translated products" , comment "Draft entry and computer-readable sequence for [Proc. Natl. Acad. Sci. U.S.A. 85, 79-82 (1988)] kindly provided by S.Hanks, 03-DEC-1987." , pub { pub { muid 88124824 , article { title { name "Amino acid sequence of the BSC-1 cell growth inhibitor (polyergin) deduced from the nucleotide sequence of the cDNA" } , authors { names str { "Hanks,S." , "Armour,R." , "Baldwin,J.H." , "Maldonado,F." , "Spiess,J." , "Holley,R.W." } } , from journal { title { name "Proc. Natl. Acad. Sci. U.S.A." } , imp { date std { year 1988 } , volume "85" , pages "79-82" } } } } } , org { taxname "Cercopithecus aethiops" } } , seq-set { seq { id { giim { id 5 } , genbank { name "AGMGIBSC1" , accession "J03585" } } , descr { title "African green monkey BSC-1 cell growth inhibitor, complete cds." , genbank { source "African green monkey kidney epithelium, cDNA to mRNA." , keywords { "BSC-1 cell growth inhibitor" , "cartilage-inducing factor B" , "polyergin" , "transforming growth factor type b2" } , origin "Unreported." , date "15-JUN-1988" } } , inst { repr raw , mol rna , length 1585 , topology linear , strand ss , seq-data ncbi2na 'FFFC0A0F424231BFF73EA4F8723EFE402ED93400401004040004004 1DD7E3731FE20FBE7F7FFFFDF787F00107FFF517FF000E471EEE7899FFF8D7937AD1AD99D25EDC 5E4911D8CE852F4E64228D8A6359A9235E2427827452D55208735E256282D5568AE3F537104914 A87E7528829896889A597989988A2618A2C719428AFC4032139657DF55D600E5356547F71215C7 D20FBDAFE1B7490E8820E7D43FAE0A48BD22DFDBF920D402522E5E041A3E27B348F742D4087C13 7505499C4D84902FB80108920A60E9FD7D8EC1E39EF4E0E9F4530212817A8FC0309F11ED5E791F FB14DC30F134D50300B820F20908FE4ACF8E917513314BAE34801CC0B51CA00004BA821544DD79 C3BCF95D7121F8B441214169A0826E7FA39A5CF9FC80EE4A30F9E5C6D67F13E3F422A372AE80E8 C460540A310E507DEE7A24E56CFCE8BD211D24492AD789F330C53035209379F75F9E6ED5087C81 77053DDC713E90045423E049FDC338FB02DF90392701F7E802E908D00F10E38E30E38E18610E38 E7EC14801308897EBDB49BC0000FF8029AC40'H } , annot { { data ftable { { data rna { type mRNA } , location whole giim { id 5 } , qual { { qual "note" , val "polyergin mRNA" } } } , { data imp { key "mat_peptide" } , location int { from 1105 , to 1440 , id giim { id 5 } } , qual { { qual "note" , val "polyergin" } } } } } } } , seq { id { giim { id 6 } } , descr { title "polyergin precursor" , method concept-trans } , inst { repr raw , mol aa , length 414 , seq-data iupacaa "MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPE DYPEPEEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFD VSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWL HHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSY RLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLY NTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS" } } } , annot { { data ftable { { data cdregion { frame one , code { id 1 } } , product whole giim { id 6 } , location int { from 199 , to 1443 , id giim { id 5 } } , qual { { qual "note" , val "polyergin precursor" } } } } } } } , seq { id { giim { id 7 } , genbank { name "AGMKPNRSA" , accession "J00337" } } , descr { title "african green monkey kpni family interspersed repeat; ls1." , genbank { source "african green monkey liver cell dna." , keywords { "repetitive sequence" } , date "05-DEC-1983" } , org { taxname "Cercopithecus aethiops" } , pub { pub { muid 83247399 , article { title { name "kpn i family of long interspersed repeated dna sequences in primates: polymorphism of family members and evidence for transcription" } , authors { names str { "Lerman,M.I." , "Thayer,R.E." , "Singer,M.F." } } , from journal { title { name "Proc. Natl. Acad. Sci. U.S.A." } , imp { date std { year 1983 } , volume "80" , pages "3966-3970" } } } } } } , inst { repr raw , mol dna , length 1784 , topology linear , strand ds , seq-data ncbi4na '8821211884281211444A118111181228144118121128812124441248411 441228288211441411284211122128488211441118114141441212111121184411112218882184 282184418144114118211818848412118442218188122211142118881814188811841818822218 211428822148412888288212141188141111142412888111888218181411221111114142284848 144211412812228144281111411211148844144218218428122841288211148181281211442812 148112211112142184481284181221111214181814122118411121411214142228214111811212 218121828121122182141828881121112284121111121142118444411144188222828881181118 448428444411128442814281818821411142141112814122228882821212288184211111481188 211418441881114128811184811112221111221811111222814114111228144211812218821441 448144218444211141288218412812112122111112118842112111142211118841211184841828 118211128111442882142121421111811128182182142484112444211288121111844414111188 888421142812221828412111448281181822141182812114411288111888121141111121122221 821111144444218182421821111144144211144181841121412128828211114111121888184211 221121412121841111111428248282844821281414111842111821111221211841418122182821 212214881414844841881881111142214411211214184284424144284844141118444118428828 121284884484441181811188148821122188184411482148481421888412221421122221882284 448181812221111418818111821884812818411412121842121248184888188421421281888121 188421114188844112211122111842221881184181412844181114111184844212181818122184 411811818421422181111114118414882184822888421444121844184114284411122182188282 142111284421214411214111122111212282184882821282181148444118841421184141121218 441212144411444118182111212844482284881144448844444211444411441414218814412121 811281184218484441888111482814184121444841844484214211122122184421248481818481 848112111228421248828421218481822214142881114811111111111111118428411111118841 18111428820'H } } } }