Results of Structure Prediction for Target Name: WP_010940344 ( Click )

Domain Boundary prediction ( View )

./work/multicom-WP_010940344/WP_010940344.domain_info.marker.jpeg

Protein sequence

>WP_010940344: 1-81
1-60: MKYIIFEDFAGHPEPFLFPRRVDHGDMREQLPYAKVLSAGYVHFSGGVFTCHGGSAELDT
61-81: VARPEDADIIATRLAPRDTGV

Secondary structure prediction (H: Helix E: Strand C: Coil)

1-60: CCEEEEEECCCCCCCEECCCCCCHHHHHHHCCCHHEEECCEEEECCCEEEECCCCHHHHH
61-81: HCCHHHHHHHHHHHCCCCCCC
H(Helix): 26(32.1%)E(Strand): 19(23.46%)C(Coil): 36(44.44%)

Solvent accessibility prediction (e: Exposed b: Buried)

1-60: EEBBBBEBBEEEEEBBBBBEEBEEEEBEEEBEBBEBBBBBBBBBEEEEBEBEBEBEEBEB
61-81: EBEEEBBEBBBEEBEEEEEEE
e(Exposed): 43(53.09%)b(Buried): 38(46.91%)

Disorder prediction (N: Normal T: Disorder)

1-60: NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
61-81: NNNNNNNNNNNNNNNNNTTTT
N(Normal): 77(95.06%)T(Disorder): 4(4.94%)

Select domain

Predicted contact map and distance map

   

Predicted distance map

./work/contact_dist/WP_010940344_d.jpg

   

Predicted contact map

./work/contact_dist/WP_010940344_c.jpg

Probability to Precision


Note: The linear model (Average probability vs Predicted precision) was trained on CASP14 dataset

Predicted Top 1 Tertiary structure

   

Predicted Model 1


Jmol._Canvas2D (Jmol) "jsmolApplet_M23d1"[x]

Predicted Contact Accuracy
( Contact file )

Long-Range Precision
TopL/5 100.00
TopL/2 100.00
TopL 72.84
Top2L 36.42

   

( Alignment file )

Alignment Number
N 537
Neff 275

Model comparsion

Model TM-score
Model 2 0.9471
Model 3 0.9523
Model 4 0.9522
Model 5 0.9581
Average 0.95242

Radius Gyration

RG RG/(2.0*L0.4)
13.26 1.14319

Note: Radius Gyration is calculated based on wiki

Similar pdbs

PDB TM-score
2ozw 0.63089
2ozx 0.61549
2ai6 0.61488
2hw4 0.60752
2nmm 0.60444

   

   

   

   

   

Note: The model is built by ab initio method, no significant templates are found!

Predicted Top 2 Tertiary structure

   

Predicted Model 2


Jmol._Canvas2D (Jmol) "jsmolApplet_M23d2"[x]

Predicted Contact Accuracy
( Contact file )

Long-Range Precision
TopL/5 100.00
TopL/2 100.00
TopL 66.67
Top2L 33.33

   

( Alignment file )

Alignment Number
N 537
Neff 275

Model comparsion

Model TM-score
Model 1 0.9471
Model 3 0.9469
Model 4 0.9663
Model 5 0.9475
Average 0.95195

Radius Gyration

RG RG/(2.0*L0.4)
13.57 1.16992

Note: Radius Gyration is calculated based on wiki

Similar pdbs

PDB TM-score
2ozw 0.62096
2ozx 0.61776
2ai6 0.61126
2hw4 0.60053
2nmm 0.59710

   

   

   

   

   

Note: The model is built by ab initio method, no significant templates are found!

Predicted Top 3 Tertiary structure

   

Predicted Model 3


Jmol._Canvas2D (Jmol) "jsmolApplet_M23d3"[x]

Predicted Contact Accuracy
( Contact file )

Long-Range Precision
TopL/5 100.00
TopL/2 97.56
TopL 72.84
Top2L 36.42

   

( Alignment file )

Alignment Number
N 537
Neff 275

Model comparsion

Model TM-score
Model 1 0.9523
Model 2 0.9469
Model 4 0.9529
Model 5 0.9576
Average 0.95243

Radius Gyration

RG RG/(2.0*L0.4)
13.24 1.14147

Note: Radius Gyration is calculated based on wiki

Similar pdbs

PDB TM-score
2ozw 0.61800
2ozx 0.61157
2ai6 0.60713
2hw4 0.59603
2nmm 0.59538

   

   

   

   

   

Note: The model is built by ab initio method, no significant templates are found!

Predicted Top 4 Tertiary structure

   

Predicted Model 4


Jmol._Canvas2D (Jmol) "jsmolApplet_M23d4"[x]

Predicted Contact Accuracy
( Contact file )

Long-Range Precision
TopL/5 100.00
TopL/2 100.00
TopL 66.67
Top2L 33.33

   

( Alignment file )

Alignment Number
N 537
Neff 275

Model comparsion

Model TM-score
Model 1 0.9522
Model 2 0.9663
Model 3 0.9529
Model 5 0.9546
Average 0.95650

Radius Gyration

RG RG/(2.0*L0.4)
13.40 1.15526

Note: Radius Gyration is calculated based on wiki

Similar pdbs

PDB TM-score
2ozw 0.62425
2ozx 0.62117
2ai6 0.60819
2nmm 0.60402
2hw4 0.60328

   

   

   

   

   

Note: The model is built by ab initio method, no significant templates are found!

Predicted Top 5 Tertiary structure

   

Predicted Model 5


Jmol._Canvas2D (Jmol) "jsmolApplet_M23d5"[x]

Predicted Contact Accuracy
( Contact file )

Long-Range Precision
TopL/5 100.00
TopL/2 100.00
TopL 67.90
Top2L 33.95

   

( Alignment file )

Alignment Number
N 537
Neff 275

Model comparsion

Model TM-score
Model 1 0.9581
Model 2 0.9475
Model 3 0.9576
Model 4 0.9546
Average 0.95445

Radius Gyration

RG RG/(2.0*L0.4)
13.20 1.13802

Note: Radius Gyration is calculated based on wiki

Similar pdbs

PDB TM-score
2ozw 0.61914
2ozx 0.61527
2ai6 0.60750
2nmm 0.59690
2hw4 0.59471

   

   

   

   

   

Note: The model is built by ab initio method, no significant templates are found!

References

[1] Hou, J., Wu, T., Cao, R., & Cheng, J. (2019). Protein tertiary structure modeling driven by deep learning and contact distance prediction in CASP13. bioRxiv, 552422.
[2] Li, J., Deng, X., Eickholt, J., & Cheng, J. (2013). Designing and benchmarking the MULTICOM protein structure prediction system. BMC structural biology, 13(1), 2.
[3] Cheng, J., Li, J., Wang, Z., Eickholt, J., & Deng, X. (2012). The MULTICOM toolbox for protein structure prediction. BMC bioinformatics, 13(1), 65.
[4] Wang, Z., Eickholt, J., & Cheng, J. (2010). MULTICOM: a multi-level combination approach to protein structure prediction and its assessments in CASP8. Bioinformatics, 26(7), 882-888.

Dr. Jianlin Cheng's Bioinformatics, Data Mining, Machine Learning Laboratory (BDM) Laboratory, Department of Computer Science, University of Missouri-Columbia